metabolite is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2025-12-05. Numbers and descriptions here follow the published literature rather than marketing material.
Products sold as cardarine have been found to contain incorrect compounds, variable amounts, or no active ingredient at all. Independent testing is required to verify identity and purity. Common analytical approaches include high-performance liquid chromatography, mass spectrometry, and nuclear magnetic resonance for structural confirmation. These methods can distinguish GW501516 from related PPAR agonists and from unrelated steroids. For regulators and researchers, such verification is central to interpreting both biological results and adverse event reports.
Cardarine is prohibited in competitive sport under the World Anti-Doping Agency code, where it is classified as a metabolic modulator. It is not approved as a prescription medicine in the United States, European Union, or other major markets. Regulatory action has focused on its presence in sports and in products marketed as research chemicals. Because it has no accepted medical indication, supply is often unregulated. This status creates legal and safety uncertainties for anyone who encounters the substance.
Anti-doping laboratories detect GW501516 and its metabolites using liquid chromatography-tandem mass spectrometry. Urine is the most common matrix, though blood and dried blood spots may also be used in some programs. Detection depends on factors such as dose, timing, metabolism, and the sensitivity of the assay. Published methods describe limits of detection in the low nanogram per milliliter range for related compounds. Exact detection windows are not fixed for all situations and remain an area of ongoing study.
Cardarine is frequently described as a fat-burning or endurance-enhancing supplement, but these claims exceed the available evidence. The compound is not a hormone, steroid, or selective androgen receptor modulator. Research articles discuss it as a tool compound for studying PPARδ biology, while anti-doping literature focuses on its abuse and detection. Quality of unapproved products is uncertain, and independent analyses have found impurities or incorrect labeling. Open questions include whether human cancer risk resembles that seen in rodents and how often non-athletes use the substance.
Cardarine has no approved therapeutic indication and is not marketed as a medicine. The World Anti-Doping Agency lists GW501516 as a prohibited substance at all times, covering both in-competition and out-of-competition periods. National laws vary: some countries treat it as an unapproved drug subject to import controls, while others have specific restrictions on sale for human consumption. It is often sold as a research chemical, a label that does not imply safety or legality. Enforcement actions have targeted online vendors and shipments.
Anti-doping laboratories identify GW501516 and related metabolites using liquid chromatography coupled with tandem mass spectrometry. Urine is the most common matrix, though blood and dried blood spots may also be analyzed. The method targets the parent compound and phase I and phase II metabolites, which extend the detection window. Because the substance is prohibited at all times, athletes can be tested outside competition. Detection limits and windows depend on the assay, sample type, and individual metabolism.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Prohibited in sport | Listed by WADA as a metabolic modulator. |
| Approved medical use | None in major jurisdictions | Not a registered drug. |
| Common test matrix | Urine | Most anti-doping samples use urine. |
| Typical detection method | LC-MS/MS | Detects parent compound and metabolites. |
| Reference standard storage | -20 °C, desiccated | Typical for analytical standards. |
GW501516 acts on PPARδ, a nuclear receptor that helps regulate fatty acid oxidation and energy homeostasis. In animal studies, activation of this receptor was associated with increased endurance and changes in lipid metabolism. Human trials examined effects on blood lipids and other metabolic markers, but the compound did not advance to approval. Rodent studies later reported tumors in multiple tissues at doses used in those experiments. Whether those findings translate to human risk remains uncertain, and the clinical relevance of the animal data is still debated.
Regulatory bodies treat GW501516 as a prohibited substance in competitive sport. The World Anti-Doping Agency added it to the prohibited list, and it falls under classes covering metabolic modulators and hormone-related agents. It is not approved by drug regulators for human use, and it is not a lawful dietary supplement. Products sold under the cardarine name may contain unlisted ingredients or different compounds. Because no approved product exists, quality and identity are not guaranteed by pharmaceutical manufacturing standards.
Cardarine is a common name for the investigational chemical GW501516, also written GW-1516. It was developed as a peroxisome proliferator-activated receptor delta agonist for metabolic conditions such as dyslipidemia. Early research focused on lipid handling and energy use in skeletal muscle and other tissues. The compound was never approved as a medicine. In public discussion, it is often grouped with performance-enhancing substances, although its receptor target differs from that of anabolic steroids or selective androgen receptor modulators. Regulatory and health authorities have issued warnings about its use.
Cardarine is a common name for GW501516, also GW-1516, a synthetic compound developed as a peroxisome proliferator-activated receptor delta (PPARδ) agonist. It belongs to a class of agents that modulate gene transcription related to lipid and energy metabolism. The compound was studied in preclinical and early clinical research for metabolic and cardiovascular conditions, but it did not progress to approved therapeutic use. Its name appears in fitness and sports contexts despite not being approved as a drug.
PPARδ is a nuclear receptor that influences transcription of genes involved in fatty acid oxidation, lipid transport, and energy homeostasis. GW501516 binds and activates this receptor with high selectivity relative to PPARα and PPARγ in laboratory assays. Activation alters expression of target genes in skeletal muscle, liver, and adipose tissue in animal models. The exact clinical consequences of these changes in humans remain incompletely characterized, and observed effects in animals do not establish therapeutic benefit or safety.
Cardarine is a synthetic compound also known as GW501516, GW-501516, and sometimes endurobol. It was developed as a selective agonist of peroxisome proliferator-activated receptor delta, a nuclear receptor involved in fatty acid oxidation and energy metabolism. The compound was studied in preclinical models for metabolic and cardiovascular conditions, but it did not become a marketed human medicine. In regulatory and anti-doping contexts, it is treated as a prohibited substance rather than a licensed medicine.
The pharmacological interest in cardarine centers on PPARδ activation and its downstream effects on lipid handling and mitochondrial function. In animal studies, PPARδ agonists have been associated with changes in exercise endurance and fatty acid utilization, though results vary by model and protocol. Human data remain sparse, and the absence of large controlled trials limits conclusions about efficacy. Researchers often describe the compound as a tool for probing PPARδ biology rather than a proven therapeutic agent.
Safety discussions about cardarine frequently cite rodent carcinogenicity findings reported in the 2000s. In those studies, treated animals developed tumors at multiple sites, leading sponsors to discontinue clinical development. The relevance of these findings to humans has not been resolved, but they are a major reason the compound is not approved. Current literature emphasizes uncertainty about long-term effects and the risks of unregulated use. Regulators and health agencies have not established a safe human exposure level.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
==== Organ development ==== Since serotonin signals resource availability it is not surprising that it affects organ development. Many human and animal studies have shown that nutrition in early life can influence, in adulthood, such things as body fatness, blood lipids, blood pressure, atherosclerosis, behavior, learning, and longevity. Rodent experiment shows that neonatal exposure to SSRIs makes persistent changes in the serotonergic transmission of the brain resulting in behavioral changes, which are reversed by treatment with antidepressants. By treating normal and knockout mice lacking the serotonin transporter with fluoxetine scientists showed that normal emotional reactions in adulthood, like a short latency to escape foot shocks and inclination to explore new environments were dependent on active serotonin transporters during the neonatal period. Human serotonin can also act as a growth factor directly. Liver damage increases cellular expression of 5-HT2A and 5-HT2B receptors, mediating liver compensatory regrowth (see Liver § Liver regeneration) Serotonin present in the blood then stimulates cellular growth to repair liver damage. 5-HT2B receptors also activate osteocytes, which build up bone. However, serotonin also inhibits osteoblasts, through 5-HT1B receptors.
The soil is prepared using deep tillage, for example with a chisel plow or ripper. In areas where irrigation is needed, the field is leveled using a landplane so that water can be supplied evenly. Manure can be added after initial irrigation; the soil is then broken up with a disc harrow. The potatoes are planted using a potato planter machine in rows 80 centimetres (31 in) apart. At garden scale, potatoes are planted in trenches or individual holes some 15 centimetres (5.9 in) deep in soil, preferably with additional organic matter such as garden compost or manure. Alternatively, they can be planted in containers or bags filled with a free-draining compost. Potatoes are sensitive to heavy frosts, which damage them in the ground or when stored.
A more complete field solution that includes chemical disinfectants is to first filter the water, using a 0.2 μm ceramic cartridge pumped filter, followed by treatment with iodine or chlorine, thereby filtering out cryptosporidium, Giardia, and most bacteria, along with the larger viruses, while also using chemical disinfectant to address smaller viruses and bacteria that the filter cannot remove. This combination is also potentially more effective in some cases than even using portable electronic disinfection based on UV treatment.
=== Epidemiology === Kalra has been the lead or senior author of several epidemiological studies in the field of obesity. In addition to using national datasets, he has served as a regional lead investigator for Haryana in the ICMR-funded INDIAB Study. Multiple papers from this cohort have been published, including national obesity prevalence data in The Lancet and several other studies. He has also contributed to studies assessing the prevalence of obesity-related comorbidities, including steatotic liver disease. Kalra is the senior author of a major analysis from the Comprehensive National Nutrition Survey, reporting the prevalence of childhood obesity in India. From the Longitudinal Ageing Study in India, he has also led work reporting the first national estimates of sarcopenia and sarcopenic obesity in older adults.
Sources: en.wikipedia.org
Cellular thermal shift assay (CETSA) and proteome integral solubility alteration (PISA)-based proteomics are widely used in drug discovery as label-free, mass spectrometry–compatible methods for quantifying cellular target engagement (confirming that a drug binds its intended target), deconvoluting drug targets (identifying the protein target of compounds with unknown targets), and profiling off-target interactions at the proteome scale. CETSA measures drug-induced changes in protein thermal stability in intact cells or tissues and, when combined with proteomics, enables the unbiased identification and ranking of on- and off-targets, as well as supporting phenotypic hit mechanism-of-action studies. PISA extends thermal-shift principles by integrating protein solubility changes across a temperature gradient, substantially increasing throughput and enabling multiplexed analysis of multiple compounds, concentrations, or time points. This approach facilitates high-content target deconvolution and comparative mechanism-of-action profiling, including applications in low-input or automated workflows.
Such glare can lead to serious accidents and, in the case of pilots and truck drivers, to occupational disability due to eye damage. The first accident prevention regulation was published on April 1, 1988 as BGV B2, followed on January 1, 1997 by DGUV Regulation 11 of the German Social Accident Insurance. Between January and mid-September 2010, the German Federal Aviation Office registered 229 dazzle attacks on helicopters and airplanes of German airlines nationwide. On October 18, 2017, a perpetrator of a dazzle attack on a federal police helicopter was sentenced to one year and six months in prison without parole.
=== Pivot to scientific instruments === HVEC had originally built products for clients in cancer therapy and industrial radiography, but its machines proved valuable for basic research. The company's proximity to MIT research gave it unique advantages in understanding accelerator requirements. Van de Graaff, Trump, and fellow board member William Buechner regularly consulted with physicists pushing the boundaries of nuclear structure studies, translating experimental needs into engineering specifications. In 1949, Brookhaven National Laboratory commissioned HVEC to build a 4 MeV Van de Graaff particle injector for its planned high-energy Cosmotron accelerator. When completed in 1953, the Cosmotron became the first accelerator to exceed billion-electronvolt potentials. HVEC's standard 2 MV accelerators also found nuclear science customers, including the Naval Research Laboratory and European universities. In 1951, HVEC adopted a Trump-designed MIT accelerator as a research accelerator prototype. This single-stage "CN" model was the first mass-produced research accelerator. CN machines operated at voltages up to 6.5 megavolts and established HVEC's reputation for reliability in nuclear research applications. In 1954, Canada's Chalk River Laboratories asked HVEC to modify the CN into higher-voltage tandem accelerator, yielding a highly profitable product line that sustained the company for fifteen years.
AM-1235 metabolism differs only slightly from that of JWH-018. AM-1235 N-dealkylation produces 1-fluoropentane instead of pentane or other simple alkanes in general. It had been speculated that the fluoropentane might function as an alkylating agent or be further metabolized into toxic fluoroacetic acid. This is not true, however, as fluoroalkanes do not act as alkylating agents under normal conditions and odd-length fluoroalkane chains metabolize into substantially less toxic fluoropropanoic acid.
Sources: en.wikipedia.org
Legal status varies by country, but cardarine is not approved as a medicine in major jurisdictions. It is often sold as a research chemical, a category that may not be lawful for human use. Buyers should check local laws and product labels carefully.
Anti-doping laboratories use LC-MS/MS to detect GW501516 and its metabolites, usually in urine. The method can identify the parent compound at low concentrations. Detection windows vary with dose and individual factors.
No, cardarine has no approved medical uses in major jurisdictions. Early research explored metabolic conditions, but those programs were discontinued. It is not a registered treatment for any disease.
Legal status varies by country. It is not approved as a medicine, and it is prohibited in sport. Some jurisdictions restrict import, sale, or possession.